PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0672s0210.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family ARF
Protein Properties Length: 857aa    MW: 95278.5 Da    PI: 6.9254
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0672s0210.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B372.26.5e-23157258199
                             EEEE-..-HHHHTT-EE--HHH.HTT......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEE CS
                      B3   1 ffkvltpsdvlksgrlvlpkkfaeeh......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvv 81 
                             f+k+lt sd++++g +++ +++a+e+      + + + +++l+ +d++ ++W++++i+r++++r++l++GW+ Fv++++L +gD ++
  SapurV1A.0672s0210.2.p 157 FCKTLTASDTSTHGGFSVLRRHADEClppldmSRQ-PPTQELVAKDLHENEWRFRHIFRGQPRRHLLQSGWSVFVSSKRLVAGDAFI 242
                             99*****************************7333.34459********************************************** PP

                             EEE-SSSEE..EEEEE-S CS
                      B3  82 Fkldgrsefelvvkvfrk 99 
                             F   + +++el+v+v+r+
  SapurV1A.0672s0210.2.p 243 FL--RGENGELRVGVRRA 258
                             **..449999*****996 PP

2Auxin_resp119.91.9e-39283365183
              Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                             a+ha+st++ F+v+Y+Pr+s++eF+v+++++++++k+++s+GmRfkm+fe+e+++e+r++Gt+vg++d+dp+rW++SkWr+Lk
  SapurV1A.0672s0210.2.p 283 AWHAVSTGTLFTVYYKPRTSPAEFIVPFDQYMESTKNNYSIGMRFKMRFEGEEAPEQRFTGTIVGIEDADPSRWKDSKWRCLK 365
                             89*******************************************************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019362.49E-40153286IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.107.8E-41154272IPR015300DNA-binding pseudobarrel domain
CDDcd100177.86E-21155257No hitNo description
SMARTSM010191.1E-22157259IPR003340B3 DNA binding domain
PROSITE profilePS5086311.321157259IPR003340B3 DNA binding domain
PfamPF023629.4E-21157258IPR003340B3 DNA binding domain
PfamPF065071.3E-36283365IPR010525Auxin response factor
PfamPF023093.7E-10722815IPR033389AUX/IAA domain
SuperFamilySSF542771.13E-11725807No hitNo description
PROSITE profilePS5174524.965730814IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008285Biological Processnegative regulation of cell proliferation
GO:0009737Biological Processresponse to abscisic acid
GO:0009911Biological Processpositive regulation of flower development
GO:0010047Biological Processfruit dehiscence
GO:0010150Biological Processleaf senescence
GO:0010227Biological Processfloral organ abscission
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0048481Biological Processplant ovule development
GO:0005634Cellular Componentnucleus
GO:0005515Molecular Functionprotein binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 857 aa     Download sequence    Send to blast
MASSEISAKA NSGNIKGGGE SFSSGYSETM EGQKGHSTHP SSARDAETTL YKELWHACAG  60
PLVTVPREGD HVFYFPQGHL EQVEASTNQV ADQQMPVYNL PPKILCRVVN VQLKAEPDTD  120
EVFAQVTLHP LQNQDENASE KEHPPPPPPP RFHVHSFCKT LTASDTSTHG GFSVLRRHAD  180
ECLPPLDMSR QPPTQELVAK DLHENEWRFR HIFRGQPRRH LLQSGWSVFV SSKRLVAGDA  240
FIFLRGENGE LRVGVRRAMR QQSNVPSSVI SSHSMHLGVL ATAWHAVSTG TLFTVYYKPR  300
TSPAEFIVPF DQYMESTKNN YSIGMRFKMR FEGEEAPEQR FTGTIVGIED ADPSRWKDSK  360
WRCLKVRWDE TSTIPRPDRV SPWKIEPALA PPALNPLPMP RPKRPRANMV PSSPDSSVLT  420
REGSSKVTAD PSSTSRFSRV LRGQEFSTVR GNFAESNESD AAEKSVIWPP SADDEKIDVL  480
SSSRRFGSER WMSSARQEPT YTDLLSGFGA NADSSHGFGA PFVDRTAGVT NPLKKHLSDQ  540
GQFNLLANPW SIMSSGLSLN LSESNTRVPV QGSSDETTYQ AIPNIRCSAF SEYPMLHGQR  600
VEQCHGSSMM PPPPSHFDNH ACTRELMPKP QLVQEHDNRK SLDGNCKLFG IPLKISKPAS  660
PEQSGPTNMV NEPTGHTPPA SHQITSESDQ KSEHSRGSKL ADENENEKPF QVGLMRTRDN  720
HGIAQNSSTR SCTKVHKQGI ALGRSVDLTR FNNYDELIAE LDRLFEFNGE LLAPQKNWLI  780
VYTDDEDDMM LVGDDPWREF VRMVRKIVIY TREEVQKIKP GTLNSKGNEN PSGVEGGDAK  840
EAKHRPATSA SSPLNC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A1e-1775038719354Auxin response factor 1
4ldw_A1e-1775038719354Auxin response factor 1
4ldw_B1e-1775038719354Auxin response factor 1
4ldx_A1e-1775038719354Auxin response factor 1
4ldx_B1e-1775038719354Auxin response factor 1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00574DAPTransfer from AT5G62000Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002318767.10.0auxin response factor 2 family protein
SwissprotQ94JM30.0ARFB_ARATH; Auxin response factor 2
TrEMBLB9I3Y90.0B9I3Y9_POPTR; Auxin response factor
STRINGPOPTR_0012s10790.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G62000.30.0auxin response factor 2